Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.39: Penicillinase repressor [101016] (4 proteins) homologous to the MarR-like family in the DNA-binding region but has a different dimerisation subdomain automatically mapped to Pfam PF03965 |
Protein Methicillin resistance regulatory protein MecI [101017] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [101018] (5 PDB entries) |
Domain d2d45a1: 2d45 A:5-121 [131242] automatically matched to d1okrb_ protein/DNA complex |
PDB Entry: 2d45 (more details), 3.8 Å
SCOPe Domain Sequences for d2d45a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d45a1 a.4.5.39 (A:5-121) Methicillin resistance regulatory protein MecI {Staphylococcus aureus [TaxId: 1280]} tyeissaewevmniiwmkkyasanniieeiqmqkdwspktirtlitrlykkgfidrkkdn kifqyyslveesdikyktsknfinkvykggfnslvlnfvekedlsqdeieelrniln
Timeline for d2d45a1: