![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.42.8: AbfB domain [110221] (1 family) ![]() automatically mapped to Pfam PF05270 |
![]() | Family b.42.8.1: AbfB domain [110222] (1 protein) Pfam PF05270 |
![]() | Protein Alpha-L-arabinofuranosidase B (AbfB), C-terminal domain [110223] (1 species) |
![]() | Species Aspergillus kawachii [TaxId:40384] [110224] (4 PDB entries) Uniprot Q8NK89 19-499 |
![]() | Domain d2d44a2: 2d44 A:338-499 [131241] Other proteins in same PDB: d2d44a1 automatically matched to d1wd3a2 complexed with ahr |
PDB Entry: 2d44 (more details), 2.3 Å
SCOPe Domain Sequences for d2d44a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d44a2 b.42.8.1 (A:338-499) Alpha-L-arabinofuranosidase B (AbfB), C-terminal domain {Aspergillus kawachii [TaxId: 40384]} lvsgpsftsgevvslrvttpgyttryiahtdttvntqvvdddssttlkeeaswtvvtgla nsqcfsfesvdtpgsyirhynfelllnandgtkqfhedatfcpqaalngegtslrswsyp tryfrhyenvlyaasnggvqtfdsktsfnndvsfeietafas
Timeline for d2d44a2: