SCOP 1.73: Domain d2d44a2: 2d44 A:338-499

Lineage for d2d44a2 (2d44 A:338-499)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.8: AbfB domain [110221] (1 family)

5. Family b.42.8.1: AbfB domain [110222] (1 protein)
   Pfam PF05270

6. Protein Alpha-L-arabinofuranosidase B (AbfB), C-terminal domain [110223] (1 species)

7. Species Aspergillus kawachii [TaxId:40384] [110224] (4 PDB entries)

8. Domain d2d44a2: 2d44 A:338-499 [131241]
   Other proteins in same PDB: d2d44a1
   automatically matched to d1wd3a2
   complexed with ahr, nag, xys; mutant

Details for d2d44a2

PDB Entry: 2d44, 2.3 Å

PDB Description: crystal structure of arabinofuranosidase complexed with arabinofuranosyl-alpha-1,2-xylobiose

PDB Compounds: (A:) alpha-L-arabinofuranosidase B

SCOP Domain Sequences for d2d44a2:

Sequence; same for both SEQRES and ATOM records:

>d2d44a2 b.42.8.1 (A:338-499) Alpha-L-arabinofuranosidase B (AbfB), C-terminal domain {Aspergillus kawachii [TaxId: 40384]}
lvsgpsftsgevvslrvttpgyttryiahtdttvntqvvdddssttlkeeaswtvvtgla
nsqcfsfesvdtpgsyirhynfelllnandgtkqfhedatfcpqaalngegtslrswsyp
tryfrhyenvlyaasnggvqtfdsktsfnndvsfeietafas

Timeline for d2d44a2:

• d2d44a2 is new in SCOP 1.73
  
• d2d44a2 appears in SCOP 1.75
  
• d2d44a2 appears in the current release, SCOPe 2.08