Lineage for d2d44a2 (2d44 A:338-499)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791605Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2792895Superfamily b.42.8: AbfB domain [110221] (2 families) (S)
    automatically mapped to Pfam PF05270
  5. 2792901Family b.42.8.0: automated matches [254221] (1 protein)
    not a true family
  6. 2792902Protein automated matches [254504] (2 species)
    not a true protein
  7. Species Aspergillus kawachii [TaxId:40384] [255104] (2 PDB entries)
  8. 2792907Domain d2d44a2: 2d44 A:338-499 [131241]
    Other proteins in same PDB: d2d44a1
    automated match to d1wd3a2

Details for d2d44a2

PDB Entry: 2d44 (more details), 2.3 Å

PDB Description: crystal structure of arabinofuranosidase complexed with arabinofuranosyl-alpha-1,2-xylobiose
PDB Compounds: (A:) alpha-L-arabinofuranosidase B

SCOPe Domain Sequences for d2d44a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d44a2 b.42.8.0 (A:338-499) automated matches {Aspergillus kawachii [TaxId: 40384]}
lvsgpsftsgevvslrvttpgyttryiahtdttvntqvvdddssttlkeeaswtvvtgla
nsqcfsfesvdtpgsyirhynfelllnandgtkqfhedatfcpqaalngegtslrswsyp
tryfrhyenvlyaasnggvqtfdsktsfnndvsfeietafas

SCOPe Domain Coordinates for d2d44a2:

Click to download the PDB-style file with coordinates for d2d44a2.
(The format of our PDB-style files is described here.)

Timeline for d2d44a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2d44a1