SCOPe 2.08: Domain d2d44a2: 2d44 A:338-499

Lineage for d2d44a2 (2d44 A:338-499)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.8: AbfB domain [110221] (2 families)
   automatically mapped to Pfam PF05270

5. Family b.42.8.0: automated matches [254221] (1 protein)
   not a true family

6. Protein automated matches [254504] (2 species)
   not a true protein

7. Species Aspergillus kawachii [TaxId:40384] [255104] (2 PDB entries)

8. Domain d2d44a2: 2d44 A:338-499 [131241]
   Other proteins in same PDB: d2d44a1
   automated match to d1wd3a2

Details for d2d44a2

PDB Entry: 2d44, 2.3 Å

PDB Description: crystal structure of arabinofuranosidase complexed with arabinofuranosyl-alpha-1,2-xylobiose

PDB Compounds: (A:) alpha-L-arabinofuranosidase B

SCOPe Domain Sequences for d2d44a2:

Sequence; same for both SEQRES and ATOM records:

>d2d44a2 b.42.8.0 (A:338-499) automated matches {Aspergillus kawachii [TaxId: 40384]}
lvsgpsftsgevvslrvttpgyttryiahtdttvntqvvdddssttlkeeaswtvvtgla
nsqcfsfesvdtpgsyirhynfelllnandgtkqfhedatfcpqaalngegtslrswsyp
tryfrhyenvlyaasnggvqtfdsktsfnndvsfeietafas

Timeline for d2d44a2:

• d2d44a2 first appeared in SCOP 1.73
  
• d2d44a2 appears in SCOPe 2.07