Lineage for d2d44a1 (2d44 A:19-337)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663169Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 663170Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 664318Family b.29.1.21: Alpha-L-arabinofuranosidase B, N-terminal domain [110143] (1 protein)
  6. 664319Protein Alpha-L-arabinofuranosidase B, N-terminal domain [110144] (1 species)
  7. 664320Species Aspergillus kawachii [TaxId:40384] [110145] (4 PDB entries)
  8. 664323Domain d2d44a1: 2d44 A:19-337 [131240]
    Other proteins in same PDB: d2d44a2
    automatically matched to d1wd3a1
    complexed with ahr, nag, xys; mutant

Details for d2d44a1

PDB Entry: 2d44 (more details), 2.3 Å

PDB Description: crystal structure of arabinofuranosidase complexed with arabinofuranosyl-alpha-1,2-xylobiose
PDB Compounds: (A:) alpha-L-arabinofuranosidase B

SCOP Domain Sequences for d2d44a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d44a1 b.29.1.21 (A:19-337) Alpha-L-arabinofuranosidase B, N-terminal domain {Aspergillus kawachii [TaxId: 40384]}
gpcdiyeagdtpcvaahsttralyssfsgalyqlqrgsddttttispltaggiadasaqd
tfcanttclitiiydqsgngnhltqappggfdgpdtdgydnlasaigapvtlngqkaygv
fmspgtgyrnneatgtatgdeaegmyavldgthyndaccfdygnaetsstdtgaghmeai
ylgnsttwgygagdgpwimvdmannlfsgadegynsgdpsisyrfvtaavkggadkwair
ganaasgslstyysgarpdysgynpmskegaiilgiggdnsngaqgtfyegvmtsgypsd
dtensvqenivaakyvvgs

SCOP Domain Coordinates for d2d44a1:

Click to download the PDB-style file with coordinates for d2d44a1.
(The format of our PDB-style files is described here.)

Timeline for d2d44a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2d44a2