SCOPe 2.08: Domain d2d44a1: 2d44 A:18-337

Lineage for d2d44a1 (2d44 A:18-337)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.21: Alpha-L-arabinofuranosidase B, N-terminal domain [110143] (2 proteins)
   automatically mapped to Pfam PF09206

6. Protein automated matches [254503] (2 species)
   not a true protein

7. Species Aspergillus kawachii [TaxId:40384] [255103] (2 PDB entries)

8. Domain d2d44a1: 2d44 A:18-337 [131240]
   Other proteins in same PDB: d2d44a2
   automated match to d1wd3a1

Details for d2d44a1

PDB Entry: 2d44, 2.3 Å

PDB Description: crystal structure of arabinofuranosidase complexed with arabinofuranosyl-alpha-1,2-xylobiose

PDB Compounds: (A:) alpha-L-arabinofuranosidase B

SCOPe Domain Sequences for d2d44a1:

Sequence; same for both SEQRES and ATOM records:

>d2d44a1 b.29.1.21 (A:18-337) automated matches {Aspergillus kawachii [TaxId: 40384]}
mgpcdiyeagdtpcvaahsttralyssfsgalyqlqrgsddttttispltaggiadasaq
dtfcanttclitiiydqsgngnhltqappggfdgpdtdgydnlasaigapvtlngqkayg
vfmspgtgyrnneatgtatgdeaegmyavldgthyndaccfdygnaetsstdtgaghmea
iylgnsttwgygagdgpwimvdmannlfsgadegynsgdpsisyrfvtaavkggadkwai
rganaasgslstyysgarpdysgynpmskegaiilgiggdnsngaqgtfyegvmtsgyps
ddtensvqenivaakyvvgs

Timeline for d2d44a1:

• d2d44a1 first appeared in SCOP 1.73
  
• d2d44a1 appears in SCOPe 2.07