![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.42.8: AbfB domain [110221] (2 families) ![]() automatically mapped to Pfam PF05270 |
![]() | Domain d2d43a2: 2d43 A:338-499 [131239] Other proteins in same PDB: d2d43a1 automated match to d1wd3a2 |
PDB Entry: 2d43 (more details), 2.8 Å
SCOPe Domain Sequences for d2d43a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d43a2 b.42.8.0 (A:338-499) automated matches {Aspergillus kawachii [TaxId: 40384]} lvsgpsftsgevvslrvttpgyttryiahtdttvntqvvdddssttlkeeaswtvvtgla nsqcfsfesvdtpgsyirhynfelllnandgtkqfhedatfcpqaalngegtslrswsyp tryfrhyenvlyaasnggvqtfdsktsfnndvsfeietafas
Timeline for d2d43a2: