Lineage for d2d43a2 (2d43 A:338-499)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 800749Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 801208Superfamily b.42.8: AbfB domain [110221] (1 family) (S)
  5. 801209Family b.42.8.1: AbfB domain [110222] (1 protein)
    Pfam PF05270
  6. 801210Protein Alpha-L-arabinofuranosidase B (AbfB), C-terminal domain [110223] (1 species)
  7. 801211Species Aspergillus kawachii [TaxId:40384] [110224] (4 PDB entries)
    Uniprot Q8NK89 19-499
  8. 801215Domain d2d43a2: 2d43 A:338-499 [131239]
    Other proteins in same PDB: d2d43a1
    automatically matched to d1wd3a2
    complexed with ahr, nag; mutant

Details for d2d43a2

PDB Entry: 2d43 (more details), 2.8 Å

PDB Description: crystal structure of arabinofuranosidase complexed with arabinotriose
PDB Compounds: (A:) alpha-L-arabinofuranosidase B

SCOP Domain Sequences for d2d43a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d43a2 b.42.8.1 (A:338-499) Alpha-L-arabinofuranosidase B (AbfB), C-terminal domain {Aspergillus kawachii [TaxId: 40384]}
lvsgpsftsgevvslrvttpgyttryiahtdttvntqvvdddssttlkeeaswtvvtgla
nsqcfsfesvdtpgsyirhynfelllnandgtkqfhedatfcpqaalngegtslrswsyp
tryfrhyenvlyaasnggvqtfdsktsfnndvsfeietafas

SCOP Domain Coordinates for d2d43a2:

Click to download the PDB-style file with coordinates for d2d43a2.
(The format of our PDB-style files is described here.)

Timeline for d2d43a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2d43a1