SCOP 1.73: Domain d2d43a1: 2d43 A:19-337

Lineage for d2d43a1 (2d43 A:19-337)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families)

5. Family b.29.1.21: Alpha-L-arabinofuranosidase B, N-terminal domain [110143] (1 protein)

6. Protein Alpha-L-arabinofuranosidase B, N-terminal domain [110144] (1 species)

7. Species Aspergillus kawachii [TaxId:40384] [110145] (4 PDB entries)

8. Domain d2d43a1: 2d43 A:19-337 [131238]
   Other proteins in same PDB: d2d43a2
   automatically matched to d1wd3a1
   complexed with ahr, nag; mutant

Details for d2d43a1

PDB Entry: 2d43, 2.8 Å

PDB Description: crystal structure of arabinofuranosidase complexed with arabinotriose

PDB Compounds: (A:) alpha-L-arabinofuranosidase B

SCOP Domain Sequences for d2d43a1:

Sequence; same for both SEQRES and ATOM records:

>d2d43a1 b.29.1.21 (A:19-337) Alpha-L-arabinofuranosidase B, N-terminal domain {Aspergillus kawachii [TaxId: 40384]}
gpcdiyeagdtpcvaahsttralyssfsgalyqlqrgsddttttispltaggiadasaqd
tfcanttclitiiydqsgngnhltqappggfdgpdtdgydnlasaigapvtlngqkaygv
fmspgtgyrnneatgtatgdeaegmyavldgthyndaccfdygnaetsstdtgaghmeai
ylgnsttwgygagdgpwimvdmannlfsgadegynsgdpsisyrfvtaavkggadkwair
ganaasgslstyysgarpdysgynpmskegaiilgiggdnsngaqgtfyegvmtsgypsd
dtensvqenivaakyvvgs

Timeline for d2d43a1:

• d2d43a1 is new in SCOP 1.73
  
• d2d43a1 appears in SCOP 1.75
  
• d2d43a1 appears in the current release, SCOPe 2.08