Lineage for d2d43a1 (2d43 A:18-337)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780511Family b.29.1.21: Alpha-L-arabinofuranosidase B, N-terminal domain [110143] (2 proteins)
    automatically mapped to Pfam PF09206
  6. 2780516Protein automated matches [254503] (2 species)
    not a true protein
  7. 2780520Species Aspergillus kawachii [TaxId:40384] [255103] (2 PDB entries)
  8. 2780522Domain d2d43a1: 2d43 A:18-337 [131238]
    Other proteins in same PDB: d2d43a2
    automated match to d1wd3a1

Details for d2d43a1

PDB Entry: 2d43 (more details), 2.8 Å

PDB Description: crystal structure of arabinofuranosidase complexed with arabinotriose
PDB Compounds: (A:) alpha-L-arabinofuranosidase B

SCOPe Domain Sequences for d2d43a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d43a1 b.29.1.21 (A:18-337) automated matches {Aspergillus kawachii [TaxId: 40384]}
mgpcdiyeagdtpcvaahsttralyssfsgalyqlqrgsddttttispltaggiadasaq
dtfcanttclitiiydqsgngnhltqappggfdgpdtdgydnlasaigapvtlngqkayg
vfmspgtgyrnneatgtatgdeaegmyavldgthyndaccfdygnaetsstdtgaghmea
iylgnsttwgygagdgpwimvdmannlfsgadegynsgdpsisyrfvtaavkggadkwai
rganaasgslstyysgarpdysgynpmskegaiilgiggdnsngaqgtfyegvmtsgyps
ddtensvqenivaakyvvgs

SCOPe Domain Coordinates for d2d43a1:

Click to download the PDB-style file with coordinates for d2d43a1.
(The format of our PDB-style files is described here.)

Timeline for d2d43a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2d43a2