Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.1: Thiolase-related [53902] (9 proteins) |
Protein Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase) [110756] (1 species) |
Species Pseudomonas fragi [TaxId:296] [110757] (4 PDB entries) Uniprot P28790 |
Domain d2d3tc2: 2d3t C:264-391 [131229] Other proteins in same PDB: d2d3ta1, d2d3ta2, d2d3ta3, d2d3ta4, d2d3tb1, d2d3tb2, d2d3tb3, d2d3tb4 automatically matched to d1wdkc2 complexed with aco, nad |
PDB Entry: 2d3t (more details), 3.4 Å
SCOPe Domain Sequences for d2d3tc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d3tc2 c.95.1.1 (C:264-391) Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase) {Pseudomonas fragi [TaxId: 296]} gleplavirsmavagvdpaimgygpvpatqkalkraglnmadidfielneafaaqalpvl kdlkvldkmnekvnlhggaialghpfgcsgarisgtllnvmkqnggtfglstmciglgqg iatvferv
Timeline for d2d3tc2: