SCOPe 2.08: Domain d2d3tc2: 2d3t C:264-391

Lineage for d2d3tc2 (2d3t C:264-391)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.1: Thiolase-related [53902] (20 proteins)

6. Protein Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase), C-terminal domain [419023] (1 species)
7. Species Pseudomonas fragi [TaxId:296] [419505] (4 PDB entries)
   Uniprot P28790

8. Domain d2d3tc2: 2d3t C:264-391 [131229]
   Other proteins in same PDB: d2d3ta1, d2d3ta2, d2d3ta3, d2d3ta4, d2d3tb1, d2d3tb2, d2d3tb3, d2d3tb4, d2d3tc1, d2d3td1
   automatically matched to d1wdkc2
   complexed with aco, nad

Details for d2d3tc2

PDB Entry: 2d3t, 3.4 Å

PDB Description: Fatty Acid beta-oxidation multienzyme complex from Pseudomonas Fragi, Form V

PDB Compounds: (C:) 3-ketoacyl-CoA thiolase

SCOPe Domain Sequences for d2d3tc2:

Sequence; same for both SEQRES and ATOM records:

>d2d3tc2 c.95.1.1 (C:264-391) Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase), C-terminal domain {Pseudomonas fragi [TaxId: 296]}
gleplavirsmavagvdpaimgygpvpatqkalkraglnmadidfielneafaaqalpvl
kdlkvldkmnekvnlhggaialghpfgcsgarisgtllnvmkqnggtfglstmciglgqg
iatvferv

Timeline for d2d3tc2:

• d2d3tc2 first appeared in SCOP 1.73
  
• d2d3tc2 appears in SCOPe 2.07