Lineage for d2d3tb4 (2d3t B:1-310)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460576Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2460577Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2461344Family c.14.1.3: Crotonase-like [52103] (14 proteins)
  6. 2461466Protein Fatty oxidation complex alpha subunit, N-terminal domain [110450] (1 species)
  7. 2461467Species Pseudomonas fragi [TaxId:296] [110451] (4 PDB entries)
    Uniprot P28793
  8. 2461471Domain d2d3tb4: 2d3t B:1-310 [131227]
    Other proteins in same PDB: d2d3ta1, d2d3ta2, d2d3ta3, d2d3tb1, d2d3tb2, d2d3tb3, d2d3tc1, d2d3tc2, d2d3td1, d2d3td2
    complexed with aco, nad

Details for d2d3tb4

PDB Entry: 2d3t (more details), 3.4 Å

PDB Description: Fatty Acid beta-oxidation multienzyme complex from Pseudomonas Fragi, Form V
PDB Compounds: (B:) Fatty oxidation complex alpha subunit

SCOPe Domain Sequences for d2d3tb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d3tb4 c.14.1.3 (B:1-310) Fatty oxidation complex alpha subunit, N-terminal domain {Pseudomonas fragi [TaxId: 296]}
miyegkaitvtalesgivelkfdlkgesvnkfnrltlnelrqavdaikadasvkgvivss
gkdvfivgaditefvenfklpdaeliagnleankifsdfedlnvptvaaingialgggle
mclaadfrvmadsakiglpevklgiypgfggtvrlprligvdnavewiasgkenraedal
kvsavdavvtadklgaaaldlikraisgeldykakrqpkleklklnaieqmmafetakgf
vagqagpnypapveaiktiqkaanfgrdkaleveaagfaklaktsasncliglflndqel
kkkakvydki

SCOPe Domain Coordinates for d2d3tb4:

Click to download the PDB-style file with coordinates for d2d3tb4.
(The format of our PDB-style files is described here.)

Timeline for d2d3tb4: