| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins) the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest C-terminal domains also show some similarity |
| Protein Fatty oxidation complex alpha subunit, middle domain [110432] (1 species) |
| Species Pseudomonas fragi [TaxId:296] [110433] (4 PDB entries) Uniprot P28793 |
| Domain d2d3tb3: 2d3t B:311-496 [131226] Other proteins in same PDB: d2d3ta1, d2d3ta2, d2d3ta4, d2d3tb1, d2d3tb2, d2d3tb4, d2d3tc1, d2d3tc2, d2d3td1, d2d3td2 complexed with aco, nad |
PDB Entry: 2d3t (more details), 3.4 Å
SCOPe Domain Sequences for d2d3tb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d3tb3 c.2.1.6 (B:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]}
akdvkqaavlgagimgggiayqsaskgtpilmkdinehgieqglaeaakllvgrvdkgrm
tpakmaevlngirptlsygdfgnvdlvveavvenpkvkqavlaevenhvredailasnts
tisisllakalkrpenfvgmhffnpvhmmplvevirgekssdlavattvayakkmgknpi
vvndcp
Timeline for d2d3tb3: