![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
![]() | Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
![]() | Family a.100.1.3: HCDH C-domain-like [48187] (2 proteins) |
![]() | Protein Fatty oxidation complex alpha subunit, C-terminal domain [109949] (1 species) duplication: contains two repeats of this domain |
![]() | Species Pseudomonas fragi [TaxId:296] [109950] (4 PDB entries) Uniprot P28793 |
![]() | Domain d2d3tb2: 2d3t B:621-715 [131225] Other proteins in same PDB: d2d3ta3, d2d3ta4, d2d3tb3, d2d3tb4, d2d3tc1, d2d3tc2, d2d3td1, d2d3td2 complexed with aco, nad |
PDB Entry: 2d3t (more details), 3.4 Å
SCOPe Domain Sequences for d2d3tb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d3tb2 a.100.1.3 (B:621-715) Fatty oxidation complex alpha subunit, C-terminal domain {Pseudomonas fragi [TaxId: 296]} dvtdediinwmmiplcletvrcledgivetaaeadmglvygigfplfrggalryidsigv aefvaladqyaelgalyhptaklremakngqsffg
Timeline for d2d3tb2: