Lineage for d2d3ta3 (2d3t A:311-496)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1349311Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins)
    the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
    C-terminal domains also show some similarity
  6. 1349354Protein Fatty oxidation complex alpha subunit, middle domain [110432] (1 species)
  7. 1349355Species Pseudomonas fragi [TaxId:296] [110433] (4 PDB entries)
    Uniprot P28793
  8. 1349358Domain d2d3ta3: 2d3t A:311-496 [131222]
    Other proteins in same PDB: d2d3ta1, d2d3ta2, d2d3ta4, d2d3tb1, d2d3tb2, d2d3tb4, d2d3tc1, d2d3tc2, d2d3td1, d2d3td2
    complexed with aco, nad

Details for d2d3ta3

PDB Entry: 2d3t (more details), 3.4 Å

PDB Description: Fatty Acid beta-oxidation multienzyme complex from Pseudomonas Fragi, Form V
PDB Compounds: (A:) Fatty oxidation complex alpha subunit

SCOPe Domain Sequences for d2d3ta3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d3ta3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]}
akdvkqaavlgagimgggiayqsaskgtpilmkdinehgieqglaeaakllvgrvdkgrm
tpakmaevlngirptlsygdfgnvdlvveavvenpkvkqavlaevenhvredailasnts
tisisllakalkrpenfvgmhffnpvhmmplvevirgekssdlavattvayakkmgknpi
vvndcp

SCOPe Domain Coordinates for d2d3ta3:

Click to download the PDB-style file with coordinates for d2d3ta3.
(The format of our PDB-style files is described here.)

Timeline for d2d3ta3: