Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.1: Legume lectins [49900] (5 proteins) |
Protein automated matches [190035] (28 species) not a true protein |
Species Winged bean (Psophocarpus tetragonolobus) [TaxId:3891] [187047] (1 PDB entry) |
Domain d2d3sa_: 2d3s A: [131216] automated match to d1wbfa_ complexed with a2g, ca, mn, nag, ser |
PDB Entry: 2d3s (more details), 2.35 Å
SCOPe Domain Sequences for d2d3sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d3sa_ b.29.1.1 (A:) automated matches {Winged bean (Psophocarpus tetragonolobus) [TaxId: 3891]} ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg
Timeline for d2d3sa_: