Lineage for d2d3sa_ (2d3s A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2778276Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2778888Protein automated matches [190035] (28 species)
    not a true protein
  7. 2779076Species Winged bean (Psophocarpus tetragonolobus) [TaxId:3891] [187047] (1 PDB entry)
  8. 2779077Domain d2d3sa_: 2d3s A: [131216]
    automated match to d1wbfa_
    complexed with a2g, ca, mn, nag, ser

Details for d2d3sa_

PDB Entry: 2d3s (more details), 2.35 Å

PDB Description: crystal structure of basic winged bean lectin with tn-antigen
PDB Compounds: (A:) Basic agglutinin

SCOPe Domain Sequences for d2d3sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d3sa_ b.29.1.1 (A:) automated matches {Winged bean (Psophocarpus tetragonolobus) [TaxId: 3891]}
ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg

SCOPe Domain Coordinates for d2d3sa_:

Click to download the PDB-style file with coordinates for d2d3sa_.
(The format of our PDB-style files is described here.)

Timeline for d2d3sa_: