Lineage for d2d3qb_ (2d3q B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203810Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1204251Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 1204472Family d.58.4.14: Dyp-type peroxidase-like [143265] (4 proteins)
    Pfam PF04261
  6. 1204483Protein automated matches [190591] (1 species)
    not a true protein
  7. 1204484Species Bjerkandera adusta [TaxId:5331] [187603] (6 PDB entries)
  8. 1204490Domain d2d3qb_: 2d3q B: [131215]
    Other proteins in same PDB: d2d3qa1
    automated match to d2d3qa1
    complexed with hem

Details for d2d3qb_

PDB Entry: 2d3q (more details), 2.8 Å

PDB Description: Crystal Structure of a Decolorizing Peroxidase (DyP) That Catalyses the Biological Oxidation of Anthraquinone Derivatives
PDB Compounds: (B:) Decolorizing Peroxidase

SCOPe Domain Sequences for d2d3qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d3qb_ d.58.4.14 (B:) automated matches {Bjerkandera adusta [TaxId: 5331]}
tilplnniqgdilvgmkkqkerfvffqvndatsfktalktyvperitsaailisdpsqqp
lafvnlgfsntglqalgitddlgdaqfpdgqfadaanlgddlsqwvapftgttihgvfli
gsdqddfldqftddisstfgssitqvqalsgsarpgdqaghehfgfldgisqpsvtgwet
tvfpgqavvppgiiltgrdgdtgtrpswaldgsfmafrhfqqkvpefnaytlanaipans
agnltqqegaeflgarmfgrwksgapidlaptaddpalgadpqrnnnfdysdtltdetrc
pfgahvrktnprqdlggpvdtfhamrssipygpetsdaelasgvtaqdrgllfveyqsii
gngfrfqqinwannanfpfskpitpgiepiigqttprtvggldplnqnetftvplfvipk
ggeyfflpsisaltatiaa

SCOPe Domain Coordinates for d2d3qb_:

Click to download the PDB-style file with coordinates for d2d3qb_.
(The format of our PDB-style files is described here.)

Timeline for d2d3qb_: