SCOP 1.75: Domain d2d3qb1: 2d3q B:4-442

Lineage for d2d3qb1 (2d3q B:4-442)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (23 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.14: Dyp-type peroxidase-like [143265] (3 proteins)
   Pfam PF04261

6. Protein Decolorizing peroxidase DyP [143268] (1 species)

7. Species Geotrichum candidum [TaxId:27317] [143269] (1 PDB entry)
   Uniprot Q8WZK8 60-498
   species assignment from the UniProt sequence (Id 100%); 2d3q species is Thanatephorus cucumeris

8. Domain d2d3qb1: 2d3q B:4-442 [131215]
   automatically matched to 2D3Q A:4-442
   complexed with hem

Details for d2d3qb1

PDB Entry: 2d3q, 2.8 Å

PDB Description: Crystal Structure of a Decolorizing Peroxidase (DyP) That Catalyses the Biological Oxidation of Anthraquinone Derivatives

PDB Compounds: (B:) Decolorizing Peroxidase

SCOP Domain Sequences for d2d3qb1:

Sequence; same for both SEQRES and ATOM records:

>d2d3qb1 d.58.4.14 (B:4-442) Decolorizing peroxidase DyP {Geotrichum candidum [TaxId: 27317]}
tilplnniqgdilvgmkkqkerfvffqvndatsfktalktyvperitsaailisdpsqqp
lafvnlgfsntglqalgitddlgdaqfpdgqfadaanlgddlsqwvapftgttihgvfli
gsdqddfldqftddisstfgssitqvqalsgsarpgdqaghehfgfldgisqpsvtgwet
tvfpgqavvppgiiltgrdgdtgtrpswaldgsfmafrhfqqkvpefnaytlanaipans
agnltqqegaeflgarmfgrwksgapidlaptaddpalgadpqrnnnfdysdtltdetrc
pfgahvrktnprqdlggpvdtfhamrssipygpetsdaelasgvtaqdrgllfveyqsii
gngfrfqqinwannanfpfskpitpgiepiigqttprtvggldplnqnetftvplfvipk
ggeyfflpsisaltatiaa

Timeline for d2d3qb1:

• d2d3qb1 first appeared in SCOP 1.73
  
• d2d3qb1 is called d2d3qb_ in SCOPe 2.01
  
• d2d3qb1 appears in the current release, SCOPe 2.08, called d2d3qb_