Lineage for d2d3qa1 (2d3q A:4-442)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 861406Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (23 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 861618Family d.58.4.14: Dyp-type peroxidase-like [143265] (3 proteins)
    Pfam PF04261
  6. 861619Protein Decolorizing peroxidase DyP [143268] (1 species)
  7. 861620Species Geotrichum candidum [TaxId:27317] [143269] (1 PDB entry)
    Uniprot Q8WZK8 60-498
    species assignment from the UniProt sequence (Id 100%); 2d3q species is Thanatephorus cucumeris
  8. 861621Domain d2d3qa1: 2d3q A:4-442 [131214]
    complexed with hem

Details for d2d3qa1

PDB Entry: 2d3q (more details), 2.8 Å

PDB Description: Crystal Structure of a Decolorizing Peroxidase (DyP) That Catalyses the Biological Oxidation of Anthraquinone Derivatives
PDB Compounds: (A:) Decolorizing Peroxidase

SCOP Domain Sequences for d2d3qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d3qa1 d.58.4.14 (A:4-442) Decolorizing peroxidase DyP {Geotrichum candidum [TaxId: 27317]}
tilplnniqgdilvgmkkqkerfvffqvndatsfktalktyvperitsaailisdpsqqp
lafvnlgfsntglqalgitddlgdaqfpdgqfadaanlgddlsqwvapftgttihgvfli
gsdqddfldqftddisstfgssitqvqalsgsarpgdqaghehfgfldgisqpsvtgwet
tvfpgqavvppgiiltgrdgdtgtrpswaldgsfmafrhfqqkvpefnaytlanaipans
agnltqqegaeflgarmfgrwksgapidlaptaddpalgadpqrnnnfdysdtltdetrc
pfgahvrktnprqdlggpvdtfhamrssipygpetsdaelasgvtaqdrgllfveyqsii
gngfrfqqinwannanfpfskpitpgiepiigqttprtvggldplnqnetftvplfvipk
ggeyfflpsisaltatiaa

SCOP Domain Coordinates for d2d3qa1:

Click to download the PDB-style file with coordinates for d2d3qa1.
(The format of our PDB-style files is described here.)

Timeline for d2d3qa1: