Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
Family d.58.4.14: Dyp-type peroxidase-like [143265] (4 proteins) Pfam PF04261 |
Protein Decolorizing peroxidase DyP [143268] (2 species) |
Species Geotrichum candidum [TaxId:27317] [143269] (1 PDB entry) Uniprot Q8WZK8 60-498 species assignment from the UniProt sequence (Id 100%); 2d3q species is Thanatephorus cucumeris |
Domain d2d3qa1: 2d3q A:4-442 [131214] Other proteins in same PDB: d2d3qb_ complexed with hem |
PDB Entry: 2d3q (more details), 2.8 Å
SCOPe Domain Sequences for d2d3qa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d3qa1 d.58.4.14 (A:4-442) Decolorizing peroxidase DyP {Geotrichum candidum [TaxId: 27317]} tilplnniqgdilvgmkkqkerfvffqvndatsfktalktyvperitsaailisdpsqqp lafvnlgfsntglqalgitddlgdaqfpdgqfadaanlgddlsqwvapftgttihgvfli gsdqddfldqftddisstfgssitqvqalsgsarpgdqaghehfgfldgisqpsvtgwet tvfpgqavvppgiiltgrdgdtgtrpswaldgsfmafrhfqqkvpefnaytlanaipans agnltqqegaeflgarmfgrwksgapidlaptaddpalgadpqrnnnfdysdtltdetrc pfgahvrktnprqdlggpvdtfhamrssipygpetsdaelasgvtaqdrgllfveyqsii gngfrfqqinwannanfpfskpitpgiepiigqttprtvggldplnqnetftvplfvipk ggeyfflpsisaltatiaa
Timeline for d2d3qa1: