![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
![]() | Protein Bacterial alpha-Amylase [51013] (9 species) |
![]() | Species Bacillus sp. 707 [TaxId:1416] [117297] (4 PDB entries) Uniprot P19571 38-518 |
![]() | Domain d2d3na1: 2d3n A:399-485 [131212] Other proteins in same PDB: d2d3na2 automated match to d1wpca1 complexed with ca, glc, na |
PDB Entry: 2d3n (more details), 1.9 Å
SCOPe Domain Sequences for d2d3na1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d3na1 b.71.1.1 (A:399-485) Bacterial alpha-Amylase {Bacillus sp. 707 [TaxId: 1416]} gkqndyldhhniigwtregntahpnsglatimsdgaggskwmfvgrnkagqvwsditgnr tgtvtinadgwgnfsvnggsvsiwvnk
Timeline for d2d3na1: