Lineage for d2d3la2 (2d3l A:5-398)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 682152Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 682153Family c.1.8.1: Amylase, catalytic domain [51446] (24 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 682255Protein Bacterial alpha-amylase [51447] (10 species)
  7. 682269Species Bacillus sp. 707 [TaxId:1416] [117366] (4 PDB entries)
  8. 682273Domain d2d3la2: 2d3l A:5-398 [131211]
    Other proteins in same PDB: d2d3la1
    complexed with ca, glc, na

Details for d2d3la2

PDB Entry: 2d3l (more details), 2.3 Å

PDB Description: crystal structure of maltohexaose-producing amylase from bacillus sp.707 complexed with maltopentaose.
PDB Compounds: (A:) Glucan 1,4-alpha-maltohexaosidase

SCOP Domain Sequences for d2d3la2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d3la2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 1416]}
tngtmmqyfewylpndgnhwnrlnsdasnlkskgitavwippawkgasqndvgygaydly
dlgefnqkgtvrtkygtrsqlqaavtslknngiqvygdvvmnhkggadatemvravevnp
nnrnqevtgeytieawtrfdfpgrgnthssfkwrwyhfdgvdwdqsrrlnnriykfrghg
kawdwevdtengnydylmyadidmdhpevvnelrnwgvwytntlgldgfridavkhikys
ftrdwinhvrsatgknmfavaefwkndlgaienylqktnwnhsvfdvplhynlynasksg
gnydmrnifngtvvqrhpshavtfvdnhdsqpeealesfveewfkplayaltltreqgyp
svfygdyygipthgvpamrskidpilearqkyay

SCOP Domain Coordinates for d2d3la2:

Click to download the PDB-style file with coordinates for d2d3la2.
(The format of our PDB-style files is described here.)

Timeline for d2d3la2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2d3la1