SCOPe 2.07: Domain d2d3la1: 2d3l A:399-485

Lineage for d2d3la1 (2d3l A:399-485)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Bacterial alpha-Amylase [51013] (9 species)

7. Species Bacillus sp. 707 [TaxId:1416] [117297] (4 PDB entries)
   Uniprot P19571 38-518

8. Domain d2d3la1: 2d3l A:399-485 [131210]
   Other proteins in same PDB: d2d3la2
   complexed with ca, glc, na

Details for d2d3la1

PDB Entry: 2d3l, 2.3 Å

PDB Description: crystal structure of maltohexaose-producing amylase from bacillus sp.707 complexed with maltopentaose.

PDB Compounds: (A:) Glucan 1,4-alpha-maltohexaosidase

SCOPe Domain Sequences for d2d3la1:

Sequence; same for both SEQRES and ATOM records:

>d2d3la1 b.71.1.1 (A:399-485) Bacterial alpha-Amylase {Bacillus sp. 707 [TaxId: 1416]}
gkqndyldhhniigwtregntahpnsglatimsdgaggskwmfvgrnkagqvwsditgnr
tgtvtinadgwgnfsvnggsvsiwvnk

Timeline for d2d3la1:

• d2d3la1 first appeared in SCOP 1.73
  
• d2d3la1 appears in SCOPe 2.06
  
• d2d3la1 appears in the current release, SCOPe 2.08