Lineage for d2d3la1 (2d3l A:399-485)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 675781Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 675782Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 675783Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 675874Protein Bacterial alpha-Amylase [51013] (9 species)
  7. 675892Species Bacillus sp. 707 [TaxId:1416] [117297] (4 PDB entries)
  8. 675896Domain d2d3la1: 2d3l A:399-485 [131210]
    Other proteins in same PDB: d2d3la2
    complexed with ca, glc, na

Details for d2d3la1

PDB Entry: 2d3l (more details), 2.3 Å

PDB Description: crystal structure of maltohexaose-producing amylase from bacillus sp.707 complexed with maltopentaose.
PDB Compounds: (A:) Glucan 1,4-alpha-maltohexaosidase

SCOP Domain Sequences for d2d3la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d3la1 b.71.1.1 (A:399-485) Bacterial alpha-Amylase {Bacillus sp. 707 [TaxId: 1416]}
gkqndyldhhniigwtregntahpnsglatimsdgaggskwmfvgrnkagqvwsditgnr
tgtvtinadgwgnfsvnggsvsiwvnk

SCOP Domain Coordinates for d2d3la1:

Click to download the PDB-style file with coordinates for d2d3la1.
(The format of our PDB-style files is described here.)

Timeline for d2d3la1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2d3la2