Lineage for d2d3la1 (2d3l A:399-485)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. Protein Bacterial alpha-Amylase [51013] (9 species)
  7. Species Bacillus sp. 707 [TaxId:1416] [117297] (4 PDB entries)
    Uniprot P19571 38-518
  8. Domain d2d3la1: 2d3l A:399-485 [131210]
    Other proteins in same PDB: d2d3la2
    complexed with ca, glc, na

Details for d2d3la1

PDB Entry: 2d3l (more details), 2.3 Å

PDB Description: crystal structure of maltohexaose-producing amylase from bacillus sp.707 complexed with maltopentaose.
PDB Compounds: (A:) Glucan 1,4-alpha-maltohexaosidase

SCOPe Domain Sequences for d2d3la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d3la1 b.71.1.1 (A:399-485) Bacterial alpha-Amylase {Bacillus sp. 707 [TaxId: 1416]}
gkqndyldhhniigwtregntahpnsglatimsdgaggskwmfvgrnkagqvwsditgnr
tgtvtinadgwgnfsvnggsvsiwvnk

SCOPe Domain Coordinates for d2d3la1 are not available.

Timeline for d2d3la1:

Domains from same chain:
(mouse over for more information)
d2d3la2