SCOPe 2.06: Domain d2d3ia1: 2d3i A:5-333

Lineage for d2d3ia1 (2d3i A:5-333)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (140 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [255102] (1 PDB entry)

8. Domain d2d3ia1: 2d3i A:5-333 [131208]
   automated match to d1b1xa1
   complexed with al, bct

Details for d2d3ia1

PDB Entry: 2d3i, 2.15 Å

PDB Description: Crystal Structure of Aluminum-Bound Ovotransferrin at 2.15 Angstrom Resolution

PDB Compounds: (A:) Ovotransferrin

SCOPe Domain Sequences for d2d3ia1:

Sequence; same for both SEQRES and ATOM records:

>d2d3ia1 c.94.1.0 (A:5-333) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
svirwctisspeekkcnnlrdltqqerisltcvqkatyldcikaianneadaisldggqv
feaglapyklkpiaaevyehtegsttsyyavavvkkgteftvndlqgktschtglgrsag
wnipigtlihrgaiewegiesgsveqavakffsascvpgatieqklcrqckgdpktkcar
napysgysgafhclkdgkgdvafvkhttvnenapdqkdeyellcldgsrqpvdnyktcnw
arvaahavvarddnkvediwsflskaqsdfgvdtksdfhlfgppgkkdpvlkdllfkdsa
imlkrvpslmdsqlylgfeyysaiqsmrk

Timeline for d2d3ia1:

• d2d3ia1 first appeared in SCOP 1.73
  
• d2d3ia1 appears in SCOPe 2.05
  
• d2d3ia1 appears in SCOPe 2.07
  
• d2d3ia1 appears in the current release, SCOPe 2.08