SCOP 1.73: Domain d2d3ia1: 2d3i A:5-334

Lineage for d2d3ia1 (2d3i A:5-334)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.2: Transferrin [53888] (3 proteins)
   further duplication: composed of two two-domain lobes

6. Protein Ovotransferrin [53894] (2 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [53896] (10 PDB entries)

8. Domain d2d3ia1: 2d3i A:5-334 [131208]
   automatically matched to d1aiv_1
   complexed with al, bct

Details for d2d3ia1

PDB Entry: 2d3i, 2.15 Å

PDB Description: Crystal Structure of Aluminum-Bound Ovotransferrin at 2.15 Angstrom Resolution

PDB Compounds: (A:) Ovotransferrin

SCOP Domain Sequences for d2d3ia1:

Sequence; same for both SEQRES and ATOM records:

>d2d3ia1 c.94.1.2 (A:5-334) Ovotransferrin {Chicken (Gallus gallus) [TaxId: 9031]}
svirwctisspeekkcnnlrdltqqerisltcvqkatyldcikaianneadaisldggqv
feaglapyklkpiaaevyehtegsttsyyavavvkkgteftvndlqgktschtglgrsag
wnipigtlihrgaiewegiesgsveqavakffsascvpgatieqklcrqckgdpktkcar
napysgysgafhclkdgkgdvafvkhttvnenapdqkdeyellcldgsrqpvdnyktcnw
arvaahavvarddnkvediwsflskaqsdfgvdtksdfhlfgppgkkdpvlkdllfkdsa
imlkrvpslmdsqlylgfeyysaiqsmrkd

Timeline for d2d3ia1:

• d2d3ia1 is new in SCOP 1.73
  
• d2d3ia1 appears in SCOP 1.75
  
• d2d3ia1 appears in the current release, SCOPe 2.08