Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
Protein automated matches [190039] (161 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [255102] (1 PDB entry) |
Domain d2d3ia1: 2d3i A:5-333 [131208] automated match to d1b1xa1 complexed with al, bct |
PDB Entry: 2d3i (more details), 2.15 Å
SCOPe Domain Sequences for d2d3ia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d3ia1 c.94.1.0 (A:5-333) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} svirwctisspeekkcnnlrdltqqerisltcvqkatyldcikaianneadaisldggqv feaglapyklkpiaaevyehtegsttsyyavavvkkgteftvndlqgktschtglgrsag wnipigtlihrgaiewegiesgsveqavakffsascvpgatieqklcrqckgdpktkcar napysgysgafhclkdgkgdvafvkhttvnenapdqkdeyellcldgsrqpvdnyktcnw arvaahavvarddnkvediwsflskaqsdfgvdtksdfhlfgppgkkdpvlkdllfkdsa imlkrvpslmdsqlylgfeyysaiqsmrk
Timeline for d2d3ia1: