Lineage for d2d3ec_ (2d3e C:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3039858Superfamily h.1.5: Tropomyosin [57997] (2 families) (S)
  5. 3039859Family h.1.5.1: Tropomyosin [57998] (1 protein)
  6. 3039860Protein Tropomyosin [57999] (5 species)
  7. 3039882Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [58000] (2 PDB entries)
  8. 3039885Domain d2d3ec_: 2d3e C: [131204]
    automated match to d2d3ea1

Details for d2d3ec_

PDB Entry: 2d3e (more details), 2.6 Å

PDB Description: crystal structure of the c-terminal fragment of rabbit skeletal alpha- tropomyosin
PDB Compounds: (C:) General control protein GCN4 and Tropomyosin 1 alpha chain

SCOPe Domain Sequences for d2d3ec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d3ec_ h.1.5.1 (C:) Tropomyosin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
dkveellsknyhlenevarlkklleraeeraelsegkcaeleeelktvtnnlksleaqae
kysqkedkyeeeikvlsdklkeaetraefaersvtkleksiddledelyaqklkykaise
eldhalndmt

SCOPe Domain Coordinates for d2d3ec_:

Click to download the PDB-style file with coordinates for d2d3ec_.
(The format of our PDB-style files is described here.)

Timeline for d2d3ec_: