![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
![]() | Superfamily h.1.5: Tropomyosin [57997] (2 families) ![]() |
![]() | Family h.1.5.1: Tropomyosin [57998] (1 protein) |
![]() | Protein Tropomyosin [57999] (5 species) |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [58000] (2 PDB entries) |
![]() | Domain d2d3ea1: 2d3e A:161-282 [131202] large C-terminal fragment, fused with the yeast GCN4 |
PDB Entry: 2d3e (more details), 2.6 Å
SCOPe Domain Sequences for d2d3ea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d3ea1 h.1.5.1 (A:161-282) Tropomyosin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} knyhlenevarlkklleraeeraelsegkcaeleeelktvtnnlksleaqaekysqkedk yeeeikvlsdklkeaetraefaersvtkleksiddledelyaqklkykaiseeldhalnd mt
Timeline for d2d3ea1: