Lineage for d2d33b_ (2d33 B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538320Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 2538321Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 2538555Family d.128.1.4: Glutamate-cysteine ligase [118090] (2 proteins)
    Pfam PF04262
  6. 2538564Protein automated matches [190259] (1 species)
    not a true protein
  7. 2538565Species Escherichia coli [TaxId:562] [187046] (2 PDB entries)
  8. 2538571Domain d2d33b_: 2d33 B: [131199]
    automated match to d1v4ga_
    complexed with adp, af3, cys, glu, mg

Details for d2d33b_

PDB Entry: 2d33 (more details), 2.6 Å

PDB Description: Crystal Structure of gamma-Glutamylcysteine Synthetase Complexed with Aluminum Fluoride
PDB Compounds: (B:) Glutamate--cysteine ligase

SCOPe Domain Sequences for d2d33b_:

Sequence, based on SEQRES records: (download)

>d2d33b_ d.128.1.4 (B:) automated matches {Escherichia coli [TaxId: 562]}
mipdvsqalawlekhpqalkgiqrgleretlrvnadgtlattghpealgsalthkwittd
faeallefitpvdgdiehmltfmrdlhrytarnmgdermwplsmpsyiaegqdielaqyg
tsntgrfktlyreglknrygalmqtisgvhynfslpmafwqaksgdisgadakekisagy
frvirnyyrfgwvipylfgaspaisssflqgkptslpfektesgmyylpyatslrlsdlg
ytnksqsnlgitfndlyeyvaglkqaiktpseeyakigiekdgkrlqinsnvlqienely
apirpkrvtrsgespsdallrggieyievrsldinpfspigvdeqqvrfldlfmvwcala
dapemssselactrvnwnrvilegrkpgltlgigcetaqfplpqvgkdlfrdlkrvaqtl
dsinggeayqkvcdelvacfdnpdltfsarilrsmidtgiggtgkafaeayrnllreepl
eilreedfvaereaserrqqemeaadtepfavwlekha

Sequence, based on observed residues (ATOM records): (download)

>d2d33b_ d.128.1.4 (B:) automated matches {Escherichia coli [TaxId: 562]}
mipdvsqalawlekhpqalkgiqrgleretlrvnadgtlattghpealgsalthkwittd
faeallefitpvdgdiehmltfmrdlhrytarnmgdermwplsmpsyiaegqdielaqyg
tsntgrfktlyreglknrygalmqtisgvhynfslpmafwqaksakekisagyfrvirny
yrfgwvipylfgaspaisssflslpfektesgmyylpyatslrlsdlgytnsnlgitfnd
lyeyvaglkqaiktpseeyakigiekdgkrlqinsnvlqienelyapirpkrvtrsgesp
sdallrggieyievrsldinpfspigvdeqqvrfldlfmvwcaladapemssselactrv
nwnrvilegrkpgltlgigcetaqfplpqvgkdlfrdlkrvaqtldsinggeayqkvcde
lvacfdnpdltfsarilrsmidtgiggtgkafaeayrnllreepleilreedfvaereas
errqqemeaadtepfavwlekha

SCOPe Domain Coordinates for d2d33b_:

Click to download the PDB-style file with coordinates for d2d33b_.
(The format of our PDB-style files is described here.)

Timeline for d2d33b_: