Lineage for d2d32a_ (2d32 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538320Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 2538321Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 2538555Family d.128.1.4: Glutamate-cysteine ligase [118090] (2 proteins)
    Pfam PF04262
  6. 2538564Protein automated matches [190259] (1 species)
    not a true protein
  7. 2538565Species Escherichia coli [TaxId:562] [187046] (2 PDB entries)
  8. 2538566Domain d2d32a_: 2d32 A: [131194]
    automated match to d1v4ga_
    complexed with anp, cys, glu, mg

Details for d2d32a_

PDB Entry: 2d32 (more details), 2.4 Å

PDB Description: Crystal Structure of Michaelis Complex of gamma-Glutamylcysteine Synthetase
PDB Compounds: (A:) Glutamate--cysteine ligase

SCOPe Domain Sequences for d2d32a_:

Sequence, based on SEQRES records: (download)

>d2d32a_ d.128.1.4 (A:) automated matches {Escherichia coli [TaxId: 562]}
mipdvsqalawlekhpqalkgiqrgleretlrvnadgtlattghpealgsalthkwittd
faeallefitpvdgdiehmltfmrdlhrytarnmgdermwplsmpsyiaegqdielaqyg
tsntgrfktlyreglknrygalmqtisgvhynfslpmafwqaksgdisgadakekisagy
frvirnyyrfgwvipylfgaspaisssflqgkptslpfektesgmyylpyatslrlsdlg
ytnksqsnlgitfndlyeyvaglkqaiktpseeyakigiekdgkrlqinsnvlqienely
apirpkrvtrsgespsdallrggieyievrsldinpfspigvdeqqvrfldlfmvwcala
dapemssselactrvnwnrvilegrkpgltlgigcetaqfplpqvgkdlfrdlkrvaqtl
dsinggeayqkvcdelvacfdnpdltfsarilrsmidtgiggtgkafaeayrnllreepl
eilreedfvaereaserrqqemeaadtepfavwlekha

Sequence, based on observed residues (ATOM records): (download)

>d2d32a_ d.128.1.4 (A:) automated matches {Escherichia coli [TaxId: 562]}
mipdvsqalawlekhpqalkgiqrgleretlrvnadgtlattghpealgsalthkwittd
faeallefitpvdgdiehmltfmrdlhrytarnmgdermwplsmpsyiaegqdielaqyg
tsntgrfktlyreglknrygalmqtisgvhynfslpmafwqaksgadakekisagyfrvi
rnyyrfgwvipylfgaspaisssfltslpfektesgmyylpyatslrlsdlgytnksqsn
lgitfndlyeyvaglkqaiktpseeyakigiekdgkrlqinsnvlqienelyapirpkrv
trsgespsdallrggieyievrsldinpfspigvdeqqvrfldlfmvwcaladapemsss
elactrvnwnrvilegrkpgltlgigcetaqfplpqvgkdlfrdlkrvaqtldsinggea
yqkvcdelvacfdnpdltfsarilrsmidtgiggtgkafaeayrnllreepleilreedf
vaereaserrqqemeaadtepfavwlekha

SCOPe Domain Coordinates for d2d32a_:

Click to download the PDB-style file with coordinates for d2d32a_.
(The format of our PDB-style files is described here.)

Timeline for d2d32a_: