SCOPe 2.08: Domain d2d2qb2: 2d2q B:199-304

Lineage for d2d2qb2 (2d2q B:199-304)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.0: automated matches [191311] (1 protein)
   not a true family

6. Protein automated matches [190052] (8 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [232271] (6 PDB entries)

8. Domain d2d2qb2: 2d2q B:199-304 [131186]
   Other proteins in same PDB: d2d2qa1, d2d2qa3, d2d2qb1, d2d2qb3
   automated match to d2zpya2

Details for d2d2qb2

PDB Entry: 2d2q, 2.8 Å

PDB Description: Crystal structure of the dimerized radixin FERM domain

PDB Compounds: (B:) Radixin

SCOPe Domain Sequences for d2d2qb2:

Sequence; same for both SEQRES and ATOM records:

>d2d2qb2 b.55.1.0 (B:199-304) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
emygvnyfeiknkkgtelwlgvdalglniyehddkltpkigfpwseirnisfndkkfvik
pidkkapdfvfyaprlrinkrilalcmgnhelymrrrkpdtievqq

Timeline for d2d2qb2:

• d2d2qb2 first appeared in SCOP 1.73
  
• d2d2qb2 appears in SCOPe 2.07