Lineage for d2d2qa1 (2d2q A:88-198)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1725169Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1725208Superfamily a.11.2: Second domain of FERM [47031] (2 families) (S)
    automatically mapped to Pfam PF00373
  5. 1725283Family a.11.2.0: automated matches [254193] (1 protein)
    not a true family
  6. 1725284Protein automated matches [254423] (3 species)
    not a true protein
  7. 1725299Species Mouse (Mus musculus) [TaxId:10090] [255101] (4 PDB entries)
  8. 1725310Domain d2d2qa1: 2d2q A:88-198 [131182]
    Other proteins in same PDB: d2d2qa2, d2d2qa3, d2d2qb2, d2d2qb3
    automated match to d2zpya1

Details for d2d2qa1

PDB Entry: 2d2q (more details), 2.8 Å

PDB Description: Crystal structure of the dimerized radixin FERM domain
PDB Compounds: (A:) Radixin

SCOPe Domain Sequences for d2d2qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d2qa1 a.11.2.0 (A:88-198) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvseeliqeitqrlfflqvkeailndeiycppetavllasyavqakygdynkeihkpgyl
andrllpqrvleqhkltkeqweeriqnwheehrgmlredsmmeylkiaqdl

SCOPe Domain Coordinates for d2d2qa1:

Click to download the PDB-style file with coordinates for d2d2qa1.
(The format of our PDB-style files is described here.)

Timeline for d2d2qa1: