Lineage for d2d2qa1 (2d2q A:88-198)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 637116Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 637131Superfamily a.11.2: Second domain of FERM [47031] (1 family) (S)
  5. 637132Family a.11.2.1: Second domain of FERM [47032] (8 proteins)
  6. 637160Protein Radixin [47035] (1 species)
  7. 637161Species Mouse (Mus musculus) [TaxId:10090] [47036] (7 PDB entries)
  8. 637172Domain d2d2qa1: 2d2q A:88-198 [131182]
    Other proteins in same PDB: d2d2qa2, d2d2qa3, d2d2qb2, d2d2qb3
    automatically matched to d1gc6a1

Details for d2d2qa1

PDB Entry: 2d2q (more details), 2.8 Å

PDB Description: Crystal structure of the dimerized radixin FERM domain
PDB Compounds: (A:) Radixin

SCOP Domain Sequences for d2d2qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d2qa1 a.11.2.1 (A:88-198) Radixin {Mouse (Mus musculus) [TaxId: 10090]}
dvseeliqeitqrlfflqvkeailndeiycppetavllasyavqakygdynkeihkpgyl
andrllpqrvleqhkltkeqweeriqnwheehrgmlredsmmeylkiaqdl

SCOP Domain Coordinates for d2d2qa1:

Click to download the PDB-style file with coordinates for d2d2qa1.
(The format of our PDB-style files is described here.)

Timeline for d2d2qa1: