SCOPe 2.08: Domain d2d2qa1: 2d2q A:88-198

Lineage for d2d2qa1 (2d2q A:88-198)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
   core: 3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.11.2: Second domain of FERM [47031] (2 families)
   automatically mapped to Pfam PF00373

5. Family a.11.2.0: automated matches [254193] (1 protein)
   not a true family

6. Protein automated matches [254423] (5 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [255101] (5 PDB entries)

8. Domain d2d2qa1: 2d2q A:88-198 [131182]
   Other proteins in same PDB: d2d2qa2, d2d2qa3, d2d2qb2, d2d2qb3
   automated match to d2zpya1

Details for d2d2qa1

PDB Entry: 2d2q, 2.8 Å

PDB Description: Crystal structure of the dimerized radixin FERM domain

PDB Compounds: (A:) Radixin

SCOPe Domain Sequences for d2d2qa1:

Sequence; same for both SEQRES and ATOM records:

>d2d2qa1 a.11.2.0 (A:88-198) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvseeliqeitqrlfflqvkeailndeiycppetavllasyavqakygdynkeihkpgyl
andrllpqrvleqhkltkeqweeriqnwheehrgmlredsmmeylkiaqdl

Timeline for d2d2qa1:

• d2d2qa1 first appeared in SCOP 1.73
  
• d2d2qa1 appears in SCOPe 2.07