Lineage for d2d2ob3 (2d2o B:121-502)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2093019Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2093379Protein Maltogenic amylase, central domain [51465] (4 species)
    contains an additional N-terminal domain
  7. 2093393Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51467] (12 PDB entries)
  8. 2093395Domain d2d2ob3: 2d2o B:121-502 [131181]
    Other proteins in same PDB: d2d2oa1, d2d2oa2, d2d2ob1, d2d2ob2
    automated match to d1jl8a3
    complexed with ca

Details for d2d2ob3

PDB Entry: 2d2o (more details), 2.1 Å

PDB Description: structure of a complex of thermoactinomyces vulgaris r-47 alpha- amylase 2 with maltohexaose demonstrates the important role of aromatic residues at the reducing end of the substrate binding cleft
PDB Compounds: (B:) Neopullulanase 2

SCOPe Domain Sequences for d2d2ob3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d2ob3 c.1.8.1 (B:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]}
vfttpewakeaviyqifperfangdpsndppgteqwakdarprhdsfyggdlkgvidrlp
yleelgvtalyftpifaspshhkydtadylaidpqfgdlptfrrlvdeahrrgikiilda
vfnhagdqffafrdvlqkgeqsrykdwffiedfpvsktsrtnyetfavqvpampklrten
pevkeylfdvarfwmeqgidgwrlnvanevdhafwrefrrlvkslnpdalivgeiwhdas
gwlmgdqfdsvmnylfresvirffatgeihaerfdaeltrarmlypeqaaqglwnlldsh
dterfltscggneakfrlavlfqmtylgtpliyygdeigmagatdpdcrrpmiweekeqn
rglfefykelirlrhrlasltr

SCOPe Domain Coordinates for d2d2ob3:

Click to download the PDB-style file with coordinates for d2d2ob3.
(The format of our PDB-style files is described here.)

Timeline for d2d2ob3: