Lineage for d2d2oa2 (2d2o A:503-585)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2810331Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2810332Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2810333Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2810619Protein Maltogenic amylase [51031] (4 species)
  7. 2810633Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51033] (12 PDB entries)
  8. 2810634Domain d2d2oa2: 2d2o A:503-585 [131177]
    Other proteins in same PDB: d2d2oa1, d2d2oa3, d2d2ob1, d2d2ob3
    automated match to d1jl8a2
    complexed with ca

Details for d2d2oa2

PDB Entry: 2d2o (more details), 2.1 Å

PDB Description: structure of a complex of thermoactinomyces vulgaris r-47 alpha- amylase 2 with maltohexaose demonstrates the important role of aromatic residues at the reducing end of the substrate binding cleft
PDB Compounds: (A:) Neopullulanase 2

SCOPe Domain Sequences for d2d2oa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d2oa2 b.71.1.1 (A:503-585) Maltogenic amylase {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]}
gnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqtvllqvpesggktwldcltgeev
hgkqgqlkltlrpyqgmilwngr

SCOPe Domain Coordinates for d2d2oa2:

Click to download the PDB-style file with coordinates for d2d2oa2.
(The format of our PDB-style files is described here.)

Timeline for d2d2oa2: