SCOP 1.75: Domain d2d2oa1: 2d2o A:1-120

Lineage for d2d2oa1 (2d2o A:1-120)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (23 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Maltogenic amylase, N-terminal domain N [49221] (4 species)
   precedes the catalytic (beta/alpha)8-barrel domain

7. Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [49223] (16 PDB entries)

8. Domain d2d2oa1: 2d2o A:1-120 [131176]
   Other proteins in same PDB: d2d2oa2, d2d2oa3, d2d2ob2, d2d2ob3
   automatically matched to d1bvza1
   complexed with ca, glc; mutant

Details for d2d2oa1

PDB Entry: 2d2o, 2.1 Å

PDB Description: structure of a complex of thermoactinomyces vulgaris r-47 alpha- amylase 2 with maltohexaose demonstrates the important role of aromatic residues at the reducing end of the substrate binding cleft

PDB Compounds: (A:) Neopullulanase 2

SCOP Domain Sequences for d2d2oa1:

Sequence; same for both SEQRES and ATOM records:

>d2d2oa1 b.1.18.2 (A:1-120) Maltogenic amylase, N-terminal domain N {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]}
mlleaifheakgsyaypisetqlrvrlrakkgdvvrcevlyadryaspeeelahalagka
gsderfdyfeallecstkrvkyvflltgpqgeavyfgetgfsaerskagvfqyayihrse

Timeline for d2d2oa1:

• d2d2oa1 first appeared in SCOP 1.73
  
• d2d2oa1 appears in SCOPe 2.01
  
• d2d2oa1 appears in the current release, SCOPe 2.08