![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) ![]() the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
![]() | Family c.1.9.3: Phosphotriesterase-like [51564] (3 proteins) automatically mapped to Pfam PF02126 |
![]() | Protein automated matches [190258] (3 species) not a true protein |
![]() | Species Agrobacterium tumefaciens [TaxId:358] [187045] (2 PDB entries) |
![]() | Domain d2d2ja_: 2d2j A: [131175] automated match to d1jgma_ complexed with co, edo |
PDB Entry: 2d2j (more details), 1.75 Å
SCOPe Domain Sequences for d2d2ja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d2ja_ c.1.9.3 (A:) automated matches {Agrobacterium tumefaciens [TaxId: 358]} tgdlintvrgpipvseagftlthehicgssagflrawpeffgsrkalaekavrglrhara agvqtivdvstfdigrdvrllaevsraadvhivaatglwfdpplsmrmrsveeltqfflr eiqhgiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtsasqrdgeqq aaifeseglspsrvcighsddtddlsyltglaargylvgldrmpysaiglegnasalalf gtrswqtrallikalidrgykdrilvshdwlfgfssyvtnimdvmdrinpdgmafvplrv ipflrekgvppetlagvtvanparflspt
Timeline for d2d2ja_: