SCOPe 2.03: Domain d2d2ja_: 2d2j A:

Lineage for d2d2ja_ (2d2j A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.3: Phosphotriesterase-like [51564] (3 proteins)
   automatically mapped to Pfam PF02126

6. Protein automated matches [190258] (2 species)
   not a true protein

7. Species Agrobacterium tumefaciens [TaxId:358] [187045] (2 PDB entries)

8. Domain d2d2ja_: 2d2j A: [131175]
   automated match to d1jgma_
   complexed with co, co2, edo

Details for d2d2ja_

PDB Entry: 2d2j, 1.75 Å

PDB Description: opda from agrobacterium radiobacter without inhibitor/product present at 1.75 a resolution

PDB Compounds: (A:) phosphotriesterase

SCOPe Domain Sequences for d2d2ja_:

Sequence; same for both SEQRES and ATOM records:

>d2d2ja_ c.1.9.3 (A:) automated matches {Agrobacterium tumefaciens [TaxId: 358]}
tgdlintvrgpipvseagftlthehicgssagflrawpeffgsrkalaekavrglrhara
agvqtivdvstfdigrdvrllaevsraadvhivaatglwfdpplsmrmrsveeltqfflr
eiqhgiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtsasqrdgeqq
aaifeseglspsrvcighsddtddlsyltglaargylvgldrmpysaiglegnasalalf
gtrswqtrallikalidrgykdrilvshdwlfgfssyvtnimdvmdrinpdgmafvplrv
ipflrekgvppetlagvtvanparflspt

Timeline for d2d2ja_:

• d2d2ja_ first appeared in SCOP 1.73, called d2d2ja1
  
• d2d2ja_ appears in SCOPe 2.02
  
• d2d2ja_ appears in SCOPe 2.04
  
• d2d2ja_ appears in the current release, SCOPe 2.08