![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.9: Metallo-dependent hydrolases [51556] (15 families) ![]() the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
![]() | Family c.1.9.3: Phosphotriesterase-like [51564] (2 proteins) |
![]() | Protein Phosphotriesterase (parathion hydrolase, PTE) [51565] (3 species) |
![]() | Species Agrobacterium tumefaciens [TaxId:358] [141815] (3 PDB entries) |
![]() | Domain d2d2ja1: 2d2j A:33-361 [131175] automatically matched to 2D2G A:33-361 complexed with co, co2, edo; mutant |
PDB Entry: 2d2j (more details), 1.75 Å
SCOP Domain Sequences for d2d2ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d2ja1 c.1.9.3 (A:33-361) Phosphotriesterase (parathion hydrolase, PTE) {Agrobacterium tumefaciens [TaxId: 358]} tgdlintvrgpipvseagftlthehicgssagflrawpeffgsrkalaekavrglrhara agvqtivdvstfdigrdvrllaevsraadvhivaatglwfdpplsmrmrsveeltqfflr eiqhgiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtsasqrdgeqq aaifeseglspsrvcighsddtddlsyltglaargylvgldrmpysaiglegnasalalf gtrswqtrallikalidrgykdrilvshdwlfgfssyvtnimdvmdrinpdgmafvplrv ipflrekgvppetlagvtvanparflspt
Timeline for d2d2ja1: