Lineage for d2d2ha1 (2d2h A:33-361)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 683612Superfamily c.1.9: Metallo-dependent hydrolases [51556] (15 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 683699Family c.1.9.3: Phosphotriesterase-like [51564] (2 proteins)
  6. 683700Protein Phosphotriesterase (parathion hydrolase, PTE) [51565] (3 species)
  7. 683701Species Agrobacterium tumefaciens [TaxId:358] [141815] (3 PDB entries)
  8. 683704Domain d2d2ha1: 2d2h A:33-361 [131174]
    automatically matched to 2D2G A:33-361
    complexed with co, co2, tzz; mutant

Details for d2d2ha1

PDB Entry: 2d2h (more details), 1.8 Å

PDB Description: opda from agrobacterium radiobacter with bound inhibitor trimethyl phosphate at 1.8 a resolution
PDB Compounds: (A:) phosphotriesterase

SCOP Domain Sequences for d2d2ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d2ha1 c.1.9.3 (A:33-361) Phosphotriesterase (parathion hydrolase, PTE) {Agrobacterium tumefaciens [TaxId: 358]}
tgdlintvrgpipvseagftlthehicgssagflrawpeffgsrkalaekavrglrhara
agvqtivdvstfdigrdvrllaevsraadvhivaatglwfdpplsmrmrsveeltqfflr
eiqhgiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtsasqrdgeqq
aaifeseglspsrvcighsddtddlsyltglaargylvgldrmpysaiglegnasalalf
gtrswqtrallikalidrgykdrilvshdwlfgfssyvtnimdvmdrinpdgmafvplrv
ipflrekgvppetlagvtvanparflspt

SCOP Domain Coordinates for d2d2ha1:

Click to download the PDB-style file with coordinates for d2d2ha1.
(The format of our PDB-style files is described here.)

Timeline for d2d2ha1: