Class b: All beta proteins [48724] (174 folds) |
Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
Superfamily b.33.1: ISP domain [50022] (4 families) |
Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins) |
Protein ISP subunit from the cytochrome b6f complex, soluble domain [101665] (2 species) |
Species Mastigocladus laminosus [TaxId:83541] [101666] (5 PDB entries) |
Domain d2d2cq1: 2d2c Q:46-179 [131169] Other proteins in same PDB: d2d2ca1, d2d2cb1, d2d2cd2, d2d2ce1, d2d2cf1, d2d2cg1, d2d2ch1, d2d2cn1, d2d2co1, d2d2cq2, d2d2cr1, d2d2cs1, d2d2ct1, d2d2cu1 automatically matched to d1vf5d1 complexed with bcr, bnt, cla, fes, hec, hem, opc |
PDB Entry: 2d2c (more details), 3.8 Å
SCOPe Domain Sequences for d2d2cq1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d2cq1 b.33.1.1 (Q:46-179) ISP subunit from the cytochrome b6f complex, soluble domain {Mastigocladus laminosus [TaxId: 83541]} sggavgggttakdklgnnvkvskfleshnagdrvlvqglkgdptyivveskeairdygin avcthlgcvvpwnaaenkfkcpchgsqydetgrvirgpaplslalchatvqddnivltpw tetdfrtgekpwwv
Timeline for d2d2cq1: