Lineage for d2d2cb1 (2d2c B:18-154)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2633244Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
    core: three transmembrane helices, up-and-down bundle
  4. 2633245Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families) (S)
  5. 2633246Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (3 proteins)
    a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 2633293Protein Subunit IV of the cytochrome b6f complex [103495] (2 species)
  7. 2633296Species Mastigocladus laminosus [TaxId:83541] [103496] (8 PDB entries)
  8. 2633305Domain d2d2cb1: 2d2c B:18-154 [131162]
    Other proteins in same PDB: d2d2ca1, d2d2cd1, d2d2cd2, d2d2ce1, d2d2cf1, d2d2cg1, d2d2ch1, d2d2cn1, d2d2cq1, d2d2cq2, d2d2cr1, d2d2cs1, d2d2ct1, d2d2cu1
    automatically matched to d1vf5b_
    complexed with bcr, bnt, cla, fes, hec, hem, opc

Details for d2d2cb1

PDB Entry: 2d2c (more details), 3.8 Å

PDB Description: Crystal Structure Of Cytochrome B6F Complex with DBMIB From M. Laminosus
PDB Compounds: (B:) Cytochrome b6-f complex subunit 4

SCOPe Domain Sequences for d2d2cb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d2cb1 f.32.1.1 (B:18-154) Subunit IV of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]}
lakgmghnyygepawpndllyvfpvvimgtfacivalsvldpamvgepanpfatpleilp
ewylypvfqilrslpnkllgvllmasvplglilvpfienvnkfqnpfrrpvattiflfgt
lvtiwlgigaalpldkt

SCOPe Domain Coordinates for d2d2cb1:

Click to download the PDB-style file with coordinates for d2d2cb1.
(The format of our PDB-style files is described here.)

Timeline for d2d2cb1: