Lineage for d2d29b1 (2d29 B:235-387)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319937Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2321545Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 2321546Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (10 proteins)
  6. 2321553Protein Acyl-CoA dehydrogenase [140473] (1 species)
  7. 2321554Species Thermus thermophilus [TaxId:274] [140474] (3 PDB entries)
    Uniprot Q5SGZ2 235-387
  8. 2321556Domain d2d29b1: 2d29 B:235-387 [131159]
    Other proteins in same PDB: d2d29a2, d2d29b2
    automated match to d1ws9a1
    complexed with fad

Details for d2d29b1

PDB Entry: 2d29 (more details), 1.65 Å

PDB Description: Structural study on project ID TT0172 from Thermus thermophilus HB8
PDB Compounds: (B:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d2d29b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d29b1 a.29.3.1 (B:235-387) Acyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]}
gkgfydvlrvldggrigiaamavglgqaaldyalayakgreafgrpiaefegvsfklaea
ateleaarllylkaaelkdagrpftleaaqaklfaseaavkacdeaiqilggygyvkdyp
verywrdarltrigegtseilklviarrlleav

SCOPe Domain Coordinates for d2d29b1:

Click to download the PDB-style file with coordinates for d2d29b1.
(The format of our PDB-style files is described here.)

Timeline for d2d29b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2d29b2