SCOPe 2.02: Domain d2d29b1: 2d29 B:235-387

Lineage for d2d29b1 (2d29 B:235-387)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (2 families)
   multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel

5. Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (9 proteins)

6. Protein Acyl-CoA dehydrogenase [140473] (1 species)

7. Species Thermus thermophilus [TaxId:274] [140474] (3 PDB entries)
   Uniprot Q5SGZ2 235-387

8. Domain d2d29b1: 2d29 B:235-387 [131159]
   Other proteins in same PDB: d2d29a2, d2d29b2
   automatically matched to 1WS9 A:235-387
   complexed with fad

Details for d2d29b1

PDB Entry: 2d29, 1.65 Å

PDB Description: Structural study on project ID TT0172 from Thermus thermophilus HB8

PDB Compounds: (B:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d2d29b1:

Sequence; same for both SEQRES and ATOM records:

>d2d29b1 a.29.3.1 (B:235-387) Acyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]}
gkgfydvlrvldggrigiaamavglgqaaldyalayakgreafgrpiaefegvsfklaea
ateleaarllylkaaelkdagrpftleaaqaklfaseaavkacdeaiqilggygyvkdyp
verywrdarltrigegtseilklviarrlleav

Timeline for d2d29b1:

• d2d29b1 first appeared in SCOP 1.73
  
• d2d29b1 appears in SCOPe 2.01
  
• d2d29b1 appears in SCOPe 2.03
  
• d2d29b1 appears in the current release, SCOPe 2.08