Lineage for d2d21a1 (2d21 A:1-370)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1008597Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1008598Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1008599Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)
  6. 1008648Protein D-maltodextrin-binding protein, MBP [53862] (5 species)
    contains a few additional helices in the C-terminal extension; homologous to thiaminase I
  7. 1008657Species Escherichia coli [TaxId:562] [53863] (47 PDB entries)
    Uniprot P02928
  8. 1008699Domain d2d21a1: 2d21 A:1-370 [131155]
    automatically matched to d1mpb__

Details for d2d21a1

PDB Entry: 2d21 (more details)

PDB Description: nmr structure of stereo-array isotope labelled (sail) maltodextrin- binding protein (mbp)
PDB Compounds: (A:) Maltose-binding periplasmic protein

SCOPe Domain Sequences for d2d21a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d21a1 c.94.1.1 (A:1-370) D-maltodextrin-binding protein, MBP {Escherichia coli [TaxId: 562]}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea
lkdaqtritk

SCOPe Domain Coordinates for d2d21a1:

Click to download the PDB-style file with coordinates for d2d21a1.
(The format of our PDB-style files is described here.)

Timeline for d2d21a1: