SCOPe 2.04: Domain d2d1yc_: 2d1y C:

Lineage for d2d1yc_ (2d1y C:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

6. Protein automated matches [190085] (43 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:274] [187600] (1 PDB entry)

8. Domain d2d1yc_: 2d1y C: [131153]
   Other proteins in same PDB: d2d1ya1
   automated match to d2d1ya1
   complexed with nad

Details for d2d1yc_

PDB Entry: 2d1y, 1.65 Å

PDB Description: crystal structure of tt0321 from thermus thermophilus hb8

PDB Compounds: (C:) hypothetical protein TT0321

SCOPe Domain Sequences for d2d1yc_:

Sequence; same for both SEQRES and ATOM records:

>d2d1yc_ c.2.1.2 (C:) automated matches {Thermus thermophilus [TaxId: 274]}
glfagkgvlvtggargigraiaqafaregalvalcdlrpegkevaeaiggaffqvdlede
rervrfveeaayalgrvdvlvnnaaiaapgsaltvrlpewrrvlevnltapmhlsalaar
emrkvgggaivnvasvqglfaeqenaaynaskgglvnltrslaldlaplrirvnavapga
iateavleaialspdpertrrdwedlhalrrlgkpeevaeavlflasekasfitgailpv
dggmtasf

Timeline for d2d1yc_:

• d2d1yc_ first appeared in SCOP 1.73, called d2d1yc1
  
• d2d1yc_ appears in SCOPe 2.03
  
• d2d1yc_ appears in SCOPe 2.05
  
• d2d1yc_ appears in the current release, SCOPe 2.08